PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584488.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 243aa    MW: 26954.8 Da    PI: 5.0497
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584488.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601345.9e-42701691100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C ++Cvlapyfp ++p+kf ++h++FGasn++kll++lpe++r+da++s+vyeA ar+rdP+yG++g i +lq+q+++l+a+la
  XP_013584488.1  70 PCAACKILRRRCGDKCVLAPYFPPTEPAKFTIAHRVFGASNIIKLLQELPESQRTDAVNSMVYEAGARIRDPIYGCAGAIYNLQRQVSELQAQLA 164
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     +++ e
  XP_013584488.1 165 KAQVE 169
                     99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.97369170IPR004883Lateral organ boundaries, LOB
PfamPF031959.5E-4270167IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MASFMMSAGS PHFVYNSIYT TYLPKSTSPS KQLIMLDMES KCDASAAIIS ASPTSSPPPP  60
QLSPRLVLSP CAACKILRRR CGDKCVLAPY FPPTEPAKFT IAHRVFGASN IIKLLQELPE  120
SQRTDAVNSM VYEAGARIRD PIYGCAGAIY NLQRQVSELQ AQLAKAQVEI VSMQLQRSNL  180
LELIHNMDQP NQELHNMSFD SSFGNCDEFI SSPDEESNDF GLLEDIKYPN TIPSTLWCDP  240
LWI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584488.10.0PREDICTED: LOB domain-containing protein 1
SwissprotQ9SK081e-99LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0D3C8E10.0A0A0D3C8E1_BRAOL; Uncharacterized protein
STRINGBra018675.1-P1e-135(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.13e-97LOB domain-containing protein 11